ABCF1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-024	50 μL

Catalog No. 89-104-024 Supplier Abnova Corporation Supplier No. H00000023A01

Description

Mouse polyclonal antibody raised against a partial recombinant ABCF1.

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the GCN20 subfamily. Unlike other members of the superfamily, this protein lacks the transmembrane domains which are characteristic of most ABC transporters. This protein may be regulated by tumor necrosis factor-alpha and play a role in enhancement of protein synthesis and the inflammation process. [provided by RefSeq

Sequence: GEMRKNHRLKIGFFNQQYAEQLRMEETPTEYLQRGFNLPYQDARKCLGRFGLESHAHTIQICKLSGGQKARVVFAELACREPDVLILDEPTNNLDIES

Specifications

• Antigen: ABCF1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ABCF1.
• Formulation: 50% glycerol
• Gene: ABCF1
• Gene Accession No.: NM_001090
• Gene Alias: ABC27/ABC50
• Gene Symbols: ABCF1
• Host Species: Mouse
• Immunogen: ABCF1 (NP_001081, 642 a.a. to 739 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 23
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only