ACACB, Mouse, Clone: 3E8, Abnova™

Catalog No.	Quantity
89-104-026	200 μL

Catalog No. 89-104-026 Supplier Abnova Corporation Supplier No. H00000032M02A

Description

Mouse monoclonal antibody raised against a partial recombinant ACACB.

Acetyl-CoA carboxylase (ACC) is a complex multifunctional enzyme system. ACC is a biotin-containing enzyme which catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the rate-limiting step in fatty acid synthesis. ACC-beta is thought to control fatty acid oxidation by means of the ability of malonyl-CoA to inhibit carnitine-palmitoyl-CoA transferase I, the rate-limiting step in fatty acid uptake and oxidation by mitochondria. ACC-beta may be involved in the regulation of fatty acid oxidation, rather than fatty acid biosynthesis. There is evidence for the presence of two ACC-beta isoforms. [provided by RefSeq

Sequence: IWGKMTDSKPITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGT

Specifications

• Antigen: ACACB
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3E8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ACACB.
• Formulation: ascites with no preservative
• Gene: ACACB
• Gene Accession No.: NM_001093
• Gene Alias: ACC2/ACCB/HACC275
• Gene Symbols: ACACB
• Host Species: Mouse
• Immunogen: ACACB (NP_001084,22 a.a. ∽ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 32
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ