ACP1, Mouse, Clone: 2A15, Abnova™

Catalog No.	Quantity
89-104-031	100 μg

Catalog No. 89-104-031 Supplier Abnova Corporation Supplier No. H00000052M10

Description

Mouse monoclonal antibody raised against a full-length recombinant ACP1.

The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq

Sequence: MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH

Specifications

• Antigen: ACP1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2A15
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant ACP1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ACP1
• Gene Accession No.: BC007422
• Gene Alias: HAAP/MGC111030/MGC3499
• Gene Symbols: ACP1
• Host Species: Mouse
• Immunogen: ACP1 (AAH07422,1 a.a. ∽ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Protein A Purification
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 52
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Purified
• Isotype: IgG2a κ