ACTN1 (M01A), Mouse anti-Human, Clone: 3F1, Abnova™

Catalog No.	Quantity
89-104-037	200 μL

Catalog No. 89-104-037 Supplier Abnova Corporation Supplier No. H00000087M01A

Description

Mouse monoclonal antibody raised against a partial recombinant ACTN1.

Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, cytoskeletal, alpha actinin isoform and maps to the same site as the structurally similar erythroid beta spectrin gene. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: EIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQA

Specifications

• Antigen: ACTN1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3F1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ACTN1.
• Formulation: ascites with no preservative
• Gene: ACTN1
• Gene Accession No.: NM_001102
• Gene Alias: FLJ40884
• Gene Symbols: ACTN1
• Host Species: Mouse
• Immunogen: ACTN1 (NP_001093,543 a.a. ∽ 639 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 87
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG3 κ