ADAMTS3, Mouse, Clone: 1D6, Abnova™

Catalog No.	Quantity
89-106-092	200 μL

Catalog No. 89-106-092 Supplier Abnova Corporation Supplier No. H00009508M08A

Description

Mouse monoclonal antibody raised against a partial recombinant ADAMTS3.

This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene is the major procollagen II N-propeptidase. A deficiency of this protein may be responsible for dermatosparaxis, a genetic defect of connective tissues. [provided by RefSeq

Sequence: ESCSKRSSTLPPPYLLEAAETHDDVISNPSDLPRSLVMPTSLVPYHSETPAKKMSLSSISSVGGPNAYAAFRPNSKPDGAN

Specifications

• Antigen: ADAMTS3
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1D6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ADAMTS3.
• Formulation: ascites with no preservative
• Gene: ADAMTS3
• Gene Accession No.: NM_014243
• Gene Alias: ADAMTS-4/KIAA0366
• Gene Symbols: ADAMTS3
• Host Species: Mouse
• Immunogen: ADAMTS3 (NP_055058.1,1048 a.a. ∽ 1128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9508
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2a κ