ADH7, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-047	50 μL

Catalog No. 89-104-047 Supplier Abnova Corporation Supplier No. H00000131A01

Description

Mouse polyclonal antibody raised against a partial recombinant ADH7.

This gene encodes class IV alcohol dehydrogenase 7 mu or sigma subunit, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The enzyme encoded by this gene is inefficient in ethanol oxidation, but is the most active as a retinol dehydrogenase; thus it may participate in the synthesis of retinoic acid, a hormone important for cellular differentiation. The expression of this gene is much more abundant in stomach than liver, thus differing from the other known gene family members. [provided by RefSeq

Sequence: MTGNNVGYTFEVIGHLETMIDALASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQLITHVLPFKKISEGFELLNSGQ

Specifications

• Antigen: ADH7
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ADH7.
• Formulation: 50% glycerol
• Gene: ADH7
• Gene Accession No.: NM_000673
• Gene Alias: ADH-4
• Gene Symbols: ADH7
• Host Species: Mouse
• Immunogen: ADH7 (NP_000664, 257 a.a. to 366 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 131
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only