AEBP1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-049	50 μL

Catalog No. 89-104-049 Supplier Abnova Corporation Supplier No. H00000165A01

Description

Mouse polyclonal antibody raised against a partial recombinant AEBP1.

The adipocyte enhancer binding protein 1 is a transcriptional repressor with carboxypeptidase (CP) activity. This protein binds to a regulatory sequence, adipocyte enhancer 1 (AE-1), located in the proximal promoter region of the adipose P2 (aP2) gene, which encodes the adipocyte fatty-acid binding protein. It is characterized as a member of the regulatory B-like CP family. This protein seems to be activated by a novel mechanism, whereby the direct binding of DNA enhances its protease activity. Adipocyte-enhancer binding protein 1 may play a role in differentiated vascular smooth muscle cells. [provided by RefSeq

Sequence: VTDEQGIPIANATISVSGINHGVKTASGGDYWRILNPGEYRVTAHAEGYTPSAKTCNVDYDIGATQCNFILARSNWKRIREIMAMNGNRPIPHIDPSRPMTP

Specifications

• Antigen: AEBP1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant AEBP1.
• Formulation: 50% glycerol
• Gene: AEBP1
• Gene Accession No.: NM_001129
• Gene Alias: ACLP/FLJ33612
• Gene Symbols: AEBP1
• Host Species: Mouse
• Immunogen: AEBP1 (NP_001120, 912 a.a. to 1013 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 165
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only