AHRR, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-107-187	50 μL

Catalog No. 89-107-187 Supplier Abnova Corporation Supplier No. H00057491A01

Description

Mouse polyclonal antibody raised against a partial recombinant AHRR.

Dioxin is a teratogen that exerts its effects through the arylhydrocarbon receptor in conjunction with the receptor's binding partner, arylhydrocarbon receptor nuclear translocator. The protein encoded by this gene represses signal transduction by the arylhydrocarbon receptor by competing with the arylhydrocarbon receptor nuclear translocator for binding to the arylhydrocarbon receptor. Expression of the repressor is stimulated by the receptor/translocator heterodimer, thereby regulating receptor function through a negative feedback mechanism. In addition, the encoded protein can bind to nuclear factor kappa-B. [provided by RefSeq]

Sequence: RATAGRSRELTPFHPAHCACLEPTDGLPQSEPPHQLCARGRGEQSCTCRAAEAAPVVKREPLDSPQWATHSQGMVPGMLPKSALATLVPPQASGCTFLP

Specifications

• Antigen: AHRR
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant AHRR.
• Formulation: 50% glycerol
• Gene: AHRR
• Gene Accession No.: NM_020731
• Gene Alias: AHH/AHHR/KIAA1234/MGC167813/MGC176630/bHLHe77
• Gene Symbols: AHRR
• Host Species: Mouse
• Immunogen: AHRR (NP_065782, 617 a.a. to 715 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 57491
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only