AKAP4, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-957	50 μL

Catalog No. 89-105-957 Supplier Abnova Corporation Supplier No. H00008852A01

Description

Mouse polyclonal antibody raised against a partial recombinant AKAP4.

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is localized to the sperm flagellum and may be involved in the regulation of sperm motility. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq

Sequence: MMAYSDTTMMSDDIDWLRSHRGVCKVDLYNPEGQQDQDRKVICFVDVSTLNVEDKDYKDAASSSSEGNLNLGSLEEKEIIVIKDTEKKDQSKTEGSVCLF

Specifications

• Antigen: AKAP4
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant AKAP4.
• Formulation: 50% glycerol
• Gene: AKAP4
• Gene Accession No.: NM_003886
• Gene Alias: AKAP82/FSC1/HI/hAKAP82/p82
• Gene Symbols: AKAP4
• Host Species: Mouse
• Immunogen: AKAP4 (NP_003877, 1 a.a. to 100 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 8852
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only