Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ANKRD17, Mouse, Clone: 1D8, Abnova™

Catalog No. 89106681 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-106-681 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-106-681 Supplier Abnova Corporation Supplier No. H00026057M01A
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant ANKRD17.

This gene encodes a protein with ankyrin repeats, which are associated with protein-protein interactions. Studies in mice suggest that this protein is involved in liver development. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: ERDSTGIVTPSGTFHQHVPAGYMDFPKVGGMPFSVYGNAMIPPVAPIPDGAGGPIFNGPHAADPSWNSLIKMVSSSTENNGPQTVWTGPWAPHMNSVHMNQLG

Specifications

Antigen ANKRD17
Applications ELISA
Classification Monoclonal
Clone 1D8
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant ANKRD17.
Formulation ascites with no preservative
Gene ANKRD17
Gene Accession No. NM_032217
Gene Alias FLJ22206/GTAR/KIAA0697/NY-BR-16
Gene Symbols ANKRD17
Host Species Mouse
Immunogen ANKRD17 (NP_115593,2501 a.a. ∽ 2603 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 26057
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.