AP1S1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length recombinant AP1S1.

Supplier:  Abnova Corporation H00001174A01

Catalog No. 89-104-290

Description

The protein encoded by this gene is part of the clathrin coat assembly complex which links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. This protein, as well as beta-prime-adaptin, gamma-adaptin, and the medium (mu) chain AP47, form the AP-1 assembly protein complex located at the Golgi vesicle. [provided by RefSeq

Sequence: MMRFMLLFSRQGKLRLRKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSTFPFSH

Specifications

• Antigen: AP1S1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length recombinant AP1S1.
• Gene: AP1S1
• Gene Alias: AP19/CLAPS1/FLJ92436/SIGMA1A/WUGSC:H_DJ0747G18.2
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: BC003561
• Gene Symbols: AP1S1
• Immunogen: AP1S1 (AAH03561, 1 a.a. to 133 a.a) full-length recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 1174
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only