APOA1, Mouse, Clone: 3A11-1A9, Abnova™

Catalog No.	Quantity
89-104-088	200 μL

Catalog No. 89-104-088 Supplier Abnova Corporation Supplier No. H00000335M01A

Description

Mouse monoclonal antibody raised against a full-length recombinant APOA1.

This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The protein promotes cholesterol efflux from tissues to the liver for excretion, and it is a cofactor for lecithin cholesterolacyltransferase (LCAT) which is responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. [provided by RefSeq

Sequence: MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ

Specifications

• Antigen: APOA1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3A11-1A9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant APOA1.
• Formulation: ascites with no preservative
• Gene: APOA1
• Gene Accession No.: BC005380
• Gene Alias: MGC117399
• Gene Symbols: APOA1
• Host Species: Mouse
• Immunogen: APOA1 (AAH05380,1 a.a. ∽ 267 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 335
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2a κ