APOBEC3G, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant APOBEC3G.

Supplier:  Abnova Corporation H00060489A01

Catalog No. 89-107-251

Description

This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. The protein encoded by this gene has been found to be a specific inhibitor of human immunodeficiency virus-1 (HIV-1) infectivity. [provided by RefSeq

Sequence: LHRDQEYEVTWYISWSPCTKCTRDMATFLAEDPKVTLTIFVARLYYFWDPDYQEALRSLCQKRDGPRATMKIMNYDEFQHCWSKFVYSQRELFEPWNNLPKY

Specifications

• Antigen: APOBEC3G
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant APOBEC3G.
• Gene: APOBEC3G
• Gene Alias: ARP9/CEM15/FLJ12740/MDS019/bK150C2.7/dJ494G10.1
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_021822
• Gene Symbols: APOBEC3G
• Immunogen: APOBEC3G (NP_068594, 80 a.a. to 181 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 60489
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only