AR, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-098	50 μL

Catalog No. 89-104-098 Supplier Abnova Corporation Supplier No. H00000367A01

Description

Mouse polyclonal antibody raised against a partial recombinant AR.

The androgen receptor gene is more than 90kb long and codes for a protein that has 3 major functional domains: the N-terminal domain, DNA-binding domain, and androgen-binding domain. The protein functions as a steroid-hormone activated transcription factor. Upon binding the hormone ligand, the receptor dissociates from accessory proteins, translocates into the nucleus, dimerizes, and then stimulates transcription of androgen responsive genes. This gene contains 2 polymorphic trinucleotide repeat segments that encode polyglutamine and polyglycine tracts in the N-terminal transactivation domain of its protein. Expansion of the polyglutamine tract causes spinal bulbar muscular atrophy (Kennedy disease). Mutations in this gene are also associated with complete androgen insensitivity (CAIS). Two alternatively spliced variants encoding distinct isoforms have been described. [provided by RefSeq

Sequence: SKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGL

Specifications

• Antigen: AR
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant AR.
• Formulation: 50% glycerol
• Gene: AR
• Gene Accession No.: NM_000044
• Gene Alias: AIS/DHTR/HUMARA/KD/NR3C4/SBMA/SMAX1/TFM
• Gene Symbols: AR
• Host Species: Mouse
• Immunogen: AR (NP_000035, 221 a.a. to 320 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 367
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only