ARID4A, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-302	50 μL

Catalog No. 89-105-302 Supplier Abnova Corporation Supplier No. H00005926A01

Description

Mouse polyclonal antibody raised against a partial recombinant ARID4A.

The protein encoded by this gene is a ubiquitously expressed nuclear protein. It binds directly, with several other proteins, to retinoblastoma protein (pRB) which regulates cell proliferation. pRB represses transcription by recruiting the encoded protein. This protein, in turn, serves as a bridging molecule to recruit HDACs and, in addition, provides a second HDAC-independent repression function. The encoded protein possesses transcriptional repression activity. Multiple alternatively spliced transcripts have been observed for this gene, although not all transcript variants have been fully described. [provided by RefSeq

Sequence: AEESQEGLCERESANGFETNVASGTCSIIVQERESREKGQKRPSDGNSGLMAKKQKRTPKRTSAAAKNEKNGTGQSSDSEDLPVLDNSSKCTPVKHLNVSKPQKLAR

Specifications

• Antigen: ARID4A
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ARID4A.
• Formulation: 50% glycerol
• Gene: ARID4A
• Gene Accession No.: NM_002892
• Gene Alias: RBBP1/RBP-1/RBP1
• Gene Symbols: ARID4A
• Host Species: Mouse
• Immunogen: ARID4A (NP_002883, 1033 a.a. to 1139 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5926
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only