ARL2BP, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-625	50 μg

Catalog No. 89-106-625 Supplier Abnova Corporation Supplier No. H00023568B01P

Description

Mouse polyclonal antibody raised against a full-length human ARL2BP protein.

ADP-ribosylation factor (ARF)-like proteins (ARLs) comprise a functionally distinct group of the ARF family of RAS-related GTPases. The protein encoded by this gene binds to ARL2.GTP with high affinity but does not interact with ARL2.GDP, activated ARF, or RHO proteins. The lack of detectable membrane association of this protein or ARL2 upon activation of ARL2 is suggestive of actions distinct from those of the ARFs. This protein is considered to be the first ARL2-specific effector identified, due to its interaction with ARL2.GTP but lack of ARL2 GTPase-activating protein activity. [provided by RefSeq

Sequence: MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH

Specifications

• Antigen: ARL2BP
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human ARL2BP protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ARL2BP
• Gene Accession No.: NM_012106.3
• Gene Alias: BART/BART1
• Gene Symbols: ARL2BP
• Host Species: Mouse
• Immunogen: ARL2BP (NP_036238.1,1 a.a. ∽ 163 a.a) full-length human protein.
• Purification Method: Affinity chromatography
• Quantity: 50 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 23568
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Purified
• Isotype: IgG

For Research Use Only