ARSB, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ARSB.

Supplier:  Abnova Corporation H00000411A01

Catalog No. 89-104-112

Description

Arylsulfatase B encoded by this gene belongs to the sulfatase family. The arylsulfatase B homodimer hydrolyzes sulfate groups of N-Acetyl-D-galactosamine, chondriotin sulfate, and dermatan sulfate. The protein is targetted to the lysozyme. Mucopolysaccharidosis type VI is an autosomal recessive lysosomal storage disorder resulting from a deficiency of arylsulfatase B. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq

Sequence: FGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHH

Specifications

• Antigen: ARSB
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant ARSB.
• Gene: ARSB
• Gene Alias: ASB/G4S/MPS6
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_198709
• Gene Symbols: ARSB
• Immunogen: ARSB (NP_942002, 166 a.a. to 265 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 411
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only