Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ARX, Mouse, Clone: 4C12, Abnova™

Catalog No. 89107679 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-107-679 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-107-679 Supplier Abnova Corporation Supplier No. H00170302M05A
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant ARX.

This gene is a homeobox-containing gene expressed during development. The expressed protein contains two conserved domains, a C-peptide (or aristaless domain) and the prd-like class homeobox domain. It is a member of the group-II aristaless-related protein family whose members are expressed primarily in the central and/or peripheral nervous system. This gene is thought to be involved in CNS development. Mutations in this gene cause X-linked mental retardation and epilepsy. [provided by RefSeq

Sequence: MSNQYQEEGCSERPECKSKSPTLLSSYCIDSILGRRSPCKMRLLGAAQSLPAPLTSRADPEKAVQGSPKSSSAPFEAELHLPPKLRRLYGPGGGR

Specifications

Antigen ARX
Applications ELISA
Classification Monoclonal
Clone 4C12
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant ARX.
Formulation ascites with no preservative
Gene ARX
Gene Accession No. NM_139058
Gene Alias ISSX/MRX29/MRX32/MRX33/MRX36/MRX38/MRX43/MRX54/MRX76/MRX87/MRXS1/PRTS
Gene Symbols ARX
Host Species Mouse
Immunogen ARX (NP_620689,1 a.a. ∽ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 170302
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgM κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.