ATF3, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-119	50 μL

Catalog No. 89-104-119 Supplier Abnova Corporation Supplier No. H00000467A01

Description

Mouse polyclonal antibody raised against a partial recombinant ATF3.

Activating transcription factor 3 is a member of the mammalian activation transcription factor/cAMP responsive element-binding (CREB) protein family of transcription factors. Multiple transcript variants encoding two different isoforms have been found for this gene. The longer isoform represses rather than activates transcription from promoters with ATF binding elements. The shorter isoform (deltaZip2) lacks the leucine zipper protein-dimerization motif and does not bind to DNA, and it stimulates transcription presumably by sequestering inhibitory co-factors away from the promoter. It is possible that alternative splicing of the ATF3 gene may be physiologically important in the regulation of target genes. [provided by RefSeq

Sequence: MMLQQPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKK

Specifications

• Antigen: ATF3
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ATF3.
• Formulation: 50% glycerol
• Gene: ATF3
• Gene Accession No.: NM_001674
• Gene Symbols: ATF3
• Host Species: Mouse
• Immunogen: ATF3 (NP_001665, 1 a.a. to 90 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 467
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only