ATOX1 (M09A), Mouse anti-Human, Clone: 3A1, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ATOX1.

Supplier:  Abnova Corporation H00000475M09A

Catalog No. 89-104-123

Description

This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome. [provided by RefSeq

Sequence: MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE

Specifications

• Antigen: ATOX1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_004045
• Gene Symbols: ATOX1
• Immunogen: ATOX1 (NP_004036,1 a.a. ∽ 68 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 475
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 3A1
• Description: Mouse monoclonal antibody raised against a partial recombinant ATOX1.
• Gene: ATOX1
• Gene Alias: ATX1/HAH1/MGC138453/MGC138455
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG