ATP11B, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ATP11B.

Supplier:  Abnova Corporation H00023200A01

Catalog No. 89-106-567

Description

P-type ATPases, such as ATP11B, are phosphorylated in their intermediate state and drive uphill transport of ions across membranes. Several subfamilies of P-type ATPases have been identified. One subfamily transports heavy metal ions, such as Cu(2+) or Cd(2+). Another subfamily transports nonheavy metal ions, such as H(+), Na(+), K(+), or Ca(+). A third subfamily transports amphipaths, such as phosphatidylserine.[supplied by OMIM

Sequence: DIIKKVFDRHLHPTSTEKAQLTETNAGIKCLDSMCCFPEGEAACASVGRMLERVIGRCSPTHISRSWSASDPFYTNDRSILTLSTMDSSTC

Specifications

• Antigen: ATP11B
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant ATP11B.
• Gene: ATP11B
• Gene Alias: ATPIF/ATPIR/DKFZp434J238/DKFZp434N1615/KIAA0956/MGC46576
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_014616
• Gene Symbols: ATP11B
• Immunogen: ATP11B (NP_055431, 1087 a.a. to 1177 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 23200
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only