ATP6V1F, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-046	50 μL

Catalog No. 89-106-046 Supplier Abnova Corporation Supplier No. H00009296A01

Description

Mouse polyclonal antibody raised against a partial recombinant ATP6V1F.

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c″, and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is the V1 domain F subunit protein. [provided by RefSeq]

Sequence: VIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR

Specifications

• Antigen: ATP6V1F
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ATP6V1F.
• Formulation: 50% glycerol
• Gene: ATP6V1F
• Gene Accession No.: NM_004231
• Gene Alias: ATP6S14/MGC117321/MGC126037/MGC126038/VATF/Vma7
• Gene Symbols: ATP6V1F
• Host Species: Mouse
• Immunogen: ATP6V1F (NP_004222, 10 a.a. to 119 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9296
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only