ATXN10, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-653	50 μL

Catalog No. 89-106-653 Supplier Abnova Corporation Supplier No. H00025814A01

Description

Mouse polyclonal antibody raised against a partial recombinant ATXN10.

The autosomal dominant cerebellar ataxias (ADCAs) are a clinically and genetically heterogeneous group of disorders characterized by ataxia, dysarthria, dysmetria, and intention tremor. All ADCAs involve some degree of cerebellar dysfunction and a varying degree of signs from other components of the nervous system. A commonly accepted clinical classification (Harding, 1993) divides ADCAs into 3 different groups based on the presence or absence of associated symptoms such as brainstem signs or retinopathy. The presence of pyramidal and extrapyramidal symptoms and ophthalmoplegia makes the diagnosis of ADCA I, the presence of retinopathy points to ADCA II, and the absence of associated signs to ADCA III. Genetic linkage and molecular analyses revealed that ADCAs are genetically heterogeneous even within the various subtypes.[supplied by OMIM

Sequence: MAAPRPPPARLSGVMVPAPIQDLEALRALTALFKEQRNRETAPRTIFQRVLDILKKSSHAVELACRDPSQVENLASSLQLITECFRCLRNACIECSVNQNSIRNLDTIG

Specifications

• Antigen: ATXN10
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ATXN10.
• Formulation: 50% glycerol
• Gene: ATXN10
• Gene Accession No.: NM_013236
• Gene Alias: E46L/FLJ37990/SCA10
• Gene Symbols: ATXN10
• Host Species: Mouse
• Immunogen: ATXN10 (NP_037368, 1 a.a. to 109 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 25814
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only