AUH, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-131	50 μL

Catalog No. 89-104-131 Supplier Abnova Corporation Supplier No. H00000549A01

Description

Mouse polyclonal antibody raised against a partial recombinant AUH.

AU-specific RNA-binding enoyl-CoA hydratase (AUH) protein binds to the AU-rich element (ARE), a common element found in the 3' UTR of rapidly decaying mRNA such as c-fos, c-myc and granulocyte/ macrophage colony stimulating factor. ARE elements are involved in directing RNA to rapid degradation and deadenylation. AUH is also homologous to enol-CoA hydratase, an enzyme involved in fatty acid degradation, and has been shown to have intrinsic hydratase enzymatic activity. AUH is thus a bifunctional chimera between RNA binding and metabolic enzyme activity. A possible subcellular localization in the mitochondria has been demonstrated for the mouse homolog of this protein which shares 92% identity with the human protein. It has been suggested that AUH may have a novel role as a mitochondrial located AU-binding protein. Human AUH is expressed as a single mRNA species of 1.8kb, and translated as a 40kDa precursor protein which is subsequently processed to a 32kDa mature form. [provided by RefSeq]

Sequence: RAGPAIWAQGWVPAAGGPAPKRGYSSEMKTEDELRVRHLEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKKVRTIIIRSEVPG

Specifications

• Antigen: AUH
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant AUH.
• Formulation: 50% glycerol
• Gene: AUH
• Gene Accession No.: NM_001698
• Gene Symbols: AUH
• Host Species: Mouse
• Immunogen: AUH (NP_001689, 44 a.a. to 135 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 549
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only