AVP, Mouse, Clone: 1H7, Abnova™

Catalog No.	Quantity
89-104-132	100 μg

Catalog No. 89-104-132 Supplier Abnova Corporation Supplier No. H00000551M07

Description

Mouse monoclonal antibody raised against a partial recombinant AVP.

This gene encodes a precursor protein consisting of arginine vasopressin and two associated proteins, neurophysin II and a glycopeptide, copeptin. Arginine vasopressin is a posterior pituitary hormone which is synthesized in the supraoptic nucleus and paraventricular nucleus of the hypothalamus. Along with its carrier protein, neurophysin II, it is packaged into neurosecretory vesicles and transported axonally to the nerve endings in the neurohypophysis where it is either stored or secreted into the bloodstream. The precursor is thought to be activated while it is being transported along the axon to the posterior pituitary. Arginine vasopressin acts as a growth factor by enhancing pH regulation through acid-base transport systems. It has a direct antidiuretic action on the kidney, and also causes vasoconstriction of the peripheral vessels. This hormone can contract smooth muscle during parturition and lactation. It is also involved in cognition, tolerance, adaptation and complex sexual and maternal behaviour, as well as in the regulation of water excretion and cardiovascular functions. Mutations in this gene cause autosomal dominant neurohypophyseal diabetes insipidus (ADNDI). [provided by RefSeq

Sequence: CYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAAFGVCCNDESCVTEPECREGFHRRA

Specifications

• Antigen: AVP
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1H7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant AVP.
• Formulation: PBS with no preservative; pH 7.4
• Gene: AVP
• Gene Accession No.: NM_000490.4
• Gene Alias: ADH/ARVP/AVP-NPII/AVRP/VP
• Gene Symbols: AVP
• Host Species: Mouse
• Immunogen: AVP (NP_000481.2,20 a.a. ∽ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Protein A Purification
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 551
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Purified
• Isotype: IgG1 κ