B3GAT1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-739	50 μL

Catalog No. 89-106-739 Supplier Abnova Corporation Supplier No. H00027087A01

Description

Mouse polyclonal antibody raised against a partial recombinant B3GAT1.

The protein encoded by this gene is a member of the glucuronyltransferase gene family. These enzymes exhibit strict acceptor specificity, recognizing nonreducing terminal sugars and their anomeric linkages. This gene product functions as the key enzyme in a glucuronyl transfer reaction during the biosynthesis of the carbohydrate epitope HNK-1 (human natural killer-1, also known as CD57 and LEU7). Alternate transcriptional splice variants have been characterized. [provided by RefSeq

Sequence: AGKVVRWKTVFDPHRPFAIDMAGFAVNLRLILQRSQAYFKLRGVKGGYQESSLLRELVTLNDLEPKAANCTKILVWHTRTEKPVLVNEGKKGFTDPSV

Specifications

• Antigen: B3GAT1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant B3GAT1.
• Formulation: 50% glycerol
• Gene: B3GAT1
• Gene Accession No.: NM_018644
• Gene Alias: CD57/GLCATP/GlcAT-P/GlcUAT-P/HNK-1/HNK1/LEU7/NK-1
• Gene Symbols: B3GAT1
• Host Species: Mouse
• Immunogen: B3GAT1 (NP_061114, 235 a.a. to 332 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 27087
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only