BAAT, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-136	50 μL

Catalog No. 89-104-136 Supplier Abnova Corporation Supplier No. H00000570A01

Description

Mouse polyclonal antibody raised against a partial recombinant BAAT.

The protein encoded by this gene is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq

Sequence: NGTNFPFGIPQVYHGQIHQPLPHSAQLISTNALGLLELYRTFETTQVGASQYLFPIEEAQGQFLFIVGEGDKTINSKAHAEQAIGQLKRHGKNNWTLL

Specifications

• Antigen: BAAT
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant BAAT.
• Formulation: 50% glycerol
• Gene: BAAT
• Gene Accession No.: NM_001701
• Gene Alias: BACAT/BAT/FLJ20300/MGC104432
• Gene Symbols: BAAT
• Host Species: Mouse
• Immunogen: BAAT (NP_001692, 258 a.a. to 355 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 570
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only