BAG1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-137	50 μL

Catalog No. 89-104-137 Supplier Abnova Corporation Supplier No. H00000573A01

Description

Mouse polyclonal antibody raised against a partial recombinant BAG1.

The oncogene BCL2 is a membrane protein that blocks a step in a pathway leading to apoptosis or programmed cell death. The protein encoded by this gene binds to BCL2 and is referred to as BCL2-associated athanogene. It enhances the anti-apoptotic effects of BCL2 and represents a link between growth factor receptors and anti-apoptotic mechanisms. At least three protein isoforms are encoded by this mRNA through the use of a non-AUG (CUG) start site, and alternative, downstream, AUG translation initiation sites. [provided by RefSeq

Sequence: EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE

Specifications

• Antigen: BAG1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant BAG1.
• Formulation: 50% glycerol
• Gene: BAG1
• Gene Accession No.: NM_004323
• Gene Alias: RAP46
• Gene Symbols: BAG1
• Host Species: Mouse
• Immunogen: BAG1 (NP_004314, 241 a.a. to 345 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 573
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only