BAG2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-099	50 μL

Catalog No. 89-106-099 Supplier Abnova Corporation Supplier No. H00009532A01

Description

Mouse polyclonal antibody raised against a partial recombinant BAG2.

BAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release. All the BAG proteins have an approximately 45-amino acid BAG domain near the C terminus but differ markedly in their N-terminal regions. The predicted BAG2 protein contains 211 amino acids. The BAG domains of BAG1, BAG2, and BAG3 interact specifically with the Hsc70 ATPase domain in vitro and in mammalian cells. All 3 proteins bind with high affinity to the ATPase domain of Hsc70 and inhibit its chaperone activity in a Hip-repressible manner. [provided by RefSeq

Sequence: RNPQQQESLKHATRIIDEVVNKFLDDLGNAKSHLMSLYSACSSEVPHGPVDQKFQSIVIGCALEDQKKIKRRLETLLRNIENSDKAIKLLEHSKGAGSKTLQQNAESRFN

Specifications

• Antigen: BAG2
• Applications: ELISA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant BAG2.
• Formulation: 50% glycerol
• Gene: BAG2
• Gene Accession No.: NM_004282
• Gene Alias: BAG-2/KIAA0576/MGC149462/dJ417I1.2
• Gene Symbols: BAG2
• Host Species: Mouse
• Immunogen: BAG2 (NP_004273, 102 a.a. to 211 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9532
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only