BAK1, Mouse, Clone: 1E4, Abnova™

Catalog No.	Quantity
89-104-139	200 μL

Catalog No. 89-104-139 Supplier Abnova Corporation Supplier No. H00000578M01A

Description

Mouse monoclonal antibody raised against a partial recombinant BAK1.

The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress. [provided by RefSeq

Sequence: LQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS

Specifications

• Antigen: BAK1
• Applications: ELISA, Immunoprecipitation
• Classification: Monoclonal
• Clone: 1E4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant BAK1.
• Formulation: ascites with no preservative
• Gene: BAK1
• Gene Accession No.: BC004431
• Gene Alias: BAK/BAK-LIKE/BCL2L7/CDN1/MGC117255/MGC3887
• Gene Symbols: BAK1
• Host Species: Mouse
• Immunogen: BAK1 (AAH04431,100 a.a. ∽ 211 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 578
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ