Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89105996

BAZ1B, Mouse, Clone: 5E9, Abnova™

Catalog No. 89105996 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-996 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-996 Supplier Abnova Corporation Supplier No. H00009031M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant BAZ1B.

This gene encodes a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. [provided by RefSeq

Sequence: MDFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQKK

Specifications

Antigen BAZ1B
Applications ELISA
Classification Monoclonal
Clone 5E9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant BAZ1B.
Formulation ascites with no preservative
Gene BAZ1B
Gene Accession No. NM_023005
Gene Alias WBSCR10/WBSCR9/WSTF
Gene Symbols BAZ1B
Host Species Mouse
Immunogen BAZ1B (NP_075381,1384 a.a. ∽ 1483 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9031
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.