BCAP31, Mouse, Clone: 3C5, Abnova™

Catalog No.	Quantity
89-106-227	200 μL

Catalog No. 89-106-227 Supplier Abnova Corporation Supplier No. H00010134M01A

Description

Mouse monoclonal antibody raised against a partial recombinant BCAP31.

This gene encodes a member of the B-cell receptor associated protein 31 superfamily. The encoded protein is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in the caspase 8-mediated apoptosis. Microdeletions in this gene are associated with the contiguous ABCD1/DXS1375E deletion syndrome. Two pseudogenes have been identified on chromosome 16. Alternatively spliced transcript variants encoding distinct isoforms have been described although the biological validity of some of the variants has not been determined. [provided by RefSeq

Sequence: KKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE

Specifications

• Antigen: BCAP31
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3C5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant BCAP31.
• Formulation: ascites with no preservative
• Gene: BCAP31
• Gene Accession No.: NM_005745
• Gene Alias: 6C6-AG/BAP31/CDM/DXS1357E
• Gene Symbols: BCAP31
• Host Species: Mouse
• Immunogen: BCAP31 (NP_005736,137 a.a. ∽ 246 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10134
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG1 κ