BCL11A, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant BCL11A.

Supplier:  Abnova Corporation H00053335A01

Catalog No. 89-106-938

Description

This gene encodes a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, through its interaction with BCL6. During hematopoietic cell differentiation, this gene is down-regulated. It is possibly involved in lymphoma pathogenesis since translocations associated with B-cell malignancies also deregulates its expression. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq

Sequence: MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPS

Specifications

• Antigen: BCL11A
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant BCL11A.
• Gene: BCL11A
• Gene Alias: BCL11A-L/BCL11A-S/BCL11A-XL/CTIP1/EVI9/FLJ10173/FLJ34997/HBFQTL5/KIAA1809/ZNF856
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_018014
• Gene Symbols: BCL11A
• Immunogen: BCL11A (NP_060484, 1 a.a. to 88 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 53335
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only