BHMT2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-643	50 μL

Catalog No. 89-106-643 Supplier Abnova Corporation Supplier No. H00023743A01

Description

Mouse polyclonal antibody raised against a partial recombinant BHMT2.

Homocysteine is a sulfur-containing amino acid that plays a crucial role in methylation reactions. Transfer of the methyl group from betaine to homocysteine creates methionine, which donates the methyl group to methylate DNA, proteins, lipids, and other intracellular metabolites. The protein encoded by this gene is one of two methyl transferases that can catalyze the transfer of the methyl group from betaine to homocysteine. Anomalies in homocysteine metabolism have been implicated in disorders ranging from vascular disease to neural tube birth defects such as spina bifida. [provided by RefSeq

Sequence: MAPAGRPGAKKGILERLESGEVVIGDGSFLITLEKRGYVKAGLWTPEAVIEHPDAVRQLHMEFLRAGSNVMQTFTFSASEDNMESKWEDVNAAACDLAREVAGKGDALVA

Specifications

• Antigen: BHMT2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant BHMT2.
• Formulation: 50% glycerol
• Gene: BHMT2
• Gene Accession No.: NM_017614
• Gene Alias: FLJ20001
• Gene Symbols: BHMT2
• Host Species: Mouse
• Immunogen: BHMT2 (NP_060084, 1 a.a. to 110 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 23743
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only