Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

BRD3, Mouse, Clone: 6C10, Abnova™

Catalog No. 89105798 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-798 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-798 Supplier Abnova Corporation Supplier No. H00008019M03A
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant BRD3.

This gene was identified based on its homology to the gene encoding the RING3 protein, a serine/threonine kinase. The gene localizes to 9q34, a region which contains several major histocompatibility complex (MHC) genes. The function of the encoded protein is not known. [provided by RefSeq

Sequence: EPVEAPALPAPAAPMVSKGAESSRSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAALSQAPVNKPKKKKEKKEKEKKKKDKEKEKEKHKVKAEEEKKAKVAPPAKQAQQKKAPAKKANSTTTAGRDHFLTCGV

Specifications

Antigen BRD3
Applications ELISA, Western Blot
Classification Monoclonal
Clone 6C10
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant BRD3.
Formulation ascites with no preservative
Gene BRD3
Gene Accession No. BC032124
Gene Alias FLJ23227/FLJ41328/KIAA0043/ORFX/RING3L
Gene Symbols BRD3
Host Species Mouse
Immunogen BRD3 (AAH32124,418 a.a. ∽ 556 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8019
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.