Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

BUB1B, Mouse, Clone: 2G9, Abnova™

Catalog No. 89104176 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-104-176 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-104-176 Supplier Abnova Corporation Supplier No. H00000701M01A
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant BUB1B.

This gene encodes a kinase involved in spindle checkpoint function. The protein has been localized to the kinetochore and plays a role in the inhibition of the anaphase-promoting complex/cyclosome (APC/C), delaying the onset of anaphase and ensuring proper chromosome segregation. Impaired spindle checkpoint function has been found in many forms of cancer. [provided by RefSeq

Sequence: MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGR

Specifications

Antigen BUB1B
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2G9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant BUB1B.
Formulation ascites with no preservative
Gene BUB1B
Gene Accession No. BC018739
Gene Alias BUB1beta/BUBR1/Bub1A/MAD3L/SSK1/hBUBR1
Gene Symbols BUB1B
Host Species Mouse
Immunogen BUB1B (AAH18739,1 a.a. ∽ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 701
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.