C1QA, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-178	50 μg

Catalog No. 89-104-178 Supplier Abnova Corporation Supplier No. H00000712B02P

Description

Mouse polyclonal antibody raised against a full-length human C1QA protein.

This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the A-chain polypeptide of human complement subcomponent C1q. [provided by RefSeq

Sequence: MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA

Specifications

• Antigen: C1QA
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human C1QA protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: C1QA
• Gene Accession No.: NM_015991.2
• Gene Symbols: C1QA
• Host Species: Mouse
• Immunogen: C1QA (NP_057075.1,1 a.a. ∽ 245 a.a) full-length human protein.
• Purification Method: Affinity chromatography
• Quantity: 50 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 712
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Purified
• Isotype: IgG

For Research Use Only