CA12, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-191	50 μL

Catalog No. 89-104-191 Supplier Abnova Corporation Supplier No. H00000771A01

Description

Mouse polyclonal antibody raised against a partial recombinant CA12.

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. This gene product is a type I membrane protein that is highly expressed in normal tissues, such as kidney, colon and pancreas, and has been found to be overexpressed in 10% of clear cell renal carcinomas. Two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq

Sequence: APVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGN

Specifications

• Antigen: CA12
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CA12.
• Formulation: 50% glycerol
• Gene: CA12
• Gene Accession No.: NM_206925
• Gene Alias: CAXII/FLJ20151/HsT18816
• Gene Symbols: CA12
• Host Species: Mouse
• Immunogen: CA12 (NP_996808, 25 a.a. to 124 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 771
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only