CA8, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-190	50 μL

Catalog No. 89-104-190 Supplier Abnova Corporation Supplier No. H00000767A01

Description

Mouse polyclonal antibody raised against a partial recombinant CA8.

The protein encoded by this gene was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, the gene product lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). The gene product continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family. The absence of CA8 gene transcription in the cerebellum of the lurcher mutant in mice with a neurologic defect suggests an important role for this acatalytic form. [provided by RefSeq

Sequence: VFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPME

Specifications

• Antigen: CA8
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CA8.
• Formulation: 50% glycerol
• Gene: CA8
• Gene Accession No.: NM_004056
• Gene Alias: CA-VIII/CALS/CARP/MGC120502/MGC99509
• Gene Symbols: CA8
• Host Species: Mouse
• Immunogen: CA8 (NP_004047, 40 a.a. to 139 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 767
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only