Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CABC1, Mouse, Clone: 6G10, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CABC1.

Manufacturer:  Abnova Corporation H00056997M02A

Catalog No. 89-107-159


Add to cart

Description

Description

This gene encodes a mitochondrial protein similar to yeast ABC1, which functions in an electron-transferring membrane protein complex in the respiratory chain. It is not related to the family of ABC transporter proteins. Expression of this gene is induced by the tumor suppressor p53 and in response to DNA damage, and inhibiting its expression partially suppresses p53-induced apoptosis. Alternatively spliced transcript variants have been found; however, their full-length nature has not been determined. [provided by RefSeq

Sequence: MAAILGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQGQDKHEEYFAENFGGPEGEFHFSVPHAAGASTDFSSASAPD
Specifications

Specifications

CABC1
Monoclonal
Unconjugated
ascites with no preservative
BC005171
ADCK3/ARCA2/COQ8/MGC4849/SCAR9
Mouse
IgM Kappa
RUO
Antibody
Monoclonal
Human
ELISA, Western Blot
6G10
Mouse monoclonal antibody raised against a partial recombinant CABC1.
CABC1
Ascites
CABC1
CABC1 (AAH05171,1 a.a. ∽ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
200 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
56997
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit