CABC1, Mouse, Clone: 6G10, Abnova™

Catalog No.	Quantity
89-107-159	200 μL

Catalog No. 89-107-159 Supplier Abnova Corporation Supplier No. H00056997M02A

Description

Mouse monoclonal antibody raised against a partial recombinant CABC1.

This gene encodes a mitochondrial protein similar to yeast ABC1, which functions in an electron-transferring membrane protein complex in the respiratory chain. It is not related to the family of ABC transporter proteins. Expression of this gene is induced by the tumor suppressor p53 and in response to DNA damage, and inhibiting its expression partially suppresses p53-induced apoptosis. Alternatively spliced transcript variants have been found; however, their full-length nature has not been determined. [provided by RefSeq

Sequence: MAAILGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQGQDKHEEYFAENFGGPEGEFHFSVPHAAGASTDFSSASAPD

Specifications

• Antigen: CABC1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 6G10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CABC1.
• Formulation: ascites with no preservative
• Gene: CABC1
• Gene Accession No.: BC005171
• Gene Alias: ADCK3/ARCA2/COQ8/MGC4849/SCAR9
• Gene Symbols: CABC1
• Host Species: Mouse
• Immunogen: CABC1 (AAH05171,1 a.a. ∽ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 56997
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ