CAMK2B (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-195	50 μL

Catalog No. 89-104-195 Supplier Abnova Corporation Supplier No. H00000816A01

Description

Mouse polyclonal antibody raised against a partial recombinant CAMK2B.

The product of this gene belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a beta chain. It is possible that distinct isoforms of this chain have different cellular localizations and interact differently with calmodulin. Eight transcript variants encoding eight distinct isoforms have been identified for this gene. [provided by RefSeq]

Sequence: FEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAPL

Specifications

• Antigen: CAMK2B
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CAMK2B.
• Formulation: 50% glycerol
• Gene: CAMK2B
• Gene Accession No.: NM_172081
• Gene Alias: CAM2/CAMK2/CAMKB/MGC29528
• Gene Symbols: CAMK2B
• Host Species: Mouse
• Immunogen: CAMK2B (NP_742078, 405 a.a. to 502 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 816
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only