Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CAPZA3, Mouse, Clone: 4D6, Abnova™

Catalog No. 89107516 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-107-516 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-107-516 Supplier Abnova Corporation Supplier No. H00093661M01A
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant CAPZA3.

This gene encodes an actin capping protein, one of the F-actin capping protein alpha subunit family. The encoded protein is predominantly localized to the neck region of ejaculated sperm, other immunohistochemical signals were found in the tail and postacrosomal regions. The encoded protein may also form heterodimers of alpha and beta subunits. This protein may be important in determining sperm architecture and male fertility. [provided by RefSeq

Sequence: NLHIEISKDLKESLEIVNQAQLALSFARLVEEQENKFQAAVLEELQELSNEALRKILRRDLPVTRTLIDWHRILSDLNLVMYPKLGYVIYSRSVLCNWII

Specifications

Antigen CAPZA3
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4D6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CAPZA3.
Formulation ascites with no preservative
Gene CAPZA3
Gene Accession No. NM_033328
Gene Alias CAPPA3/Gsg3
Gene Symbols CAPZA3
Host Species Mouse
Immunogen CAPZA3 (NP_201585,200 a.a. ∽ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 93661
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.