CARD11, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-107-448	50 μL

Catalog No. 89-107-448 Supplier Abnova Corporation Supplier No. H00084433A01

Description

Mouse polyclonal antibody raised against a partial recombinant CARD11.

The protein encoded by this gene belongs to the membrane-associated guanylate kinase (MAGUK) family, a class of proteins that functions as molecular scaffolds for the assembly of multiprotein complexes at specialized regions of the plasma membrane. This protein is also a member of the CARD protein family, which is defined by carrying a characteristic caspase-associated recruitment domain (CARD). This protein has a domain structure similar to that of CARD14 protein. The CARD domains of both proteins have been shown to specifically interact with BCL10, a protein known to function as a positive regulator of cell apoptosis and NF-kappaB activation. When expressed in cells, this protein activated NF-kappaB and induced the phosphorylation of BCL10. [provided by RefSeq

Sequence: KYFLPYHPPQRRMNLKGIQLQRAKSPISLKRTSDFQAKGHEEEGTDASPSSCGSLPITNSFTKMQPPRSRSSIMSITAEPPGNDSIVRRYKEDAPHRSTV

Specifications

• Antigen: CARD11
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CARD11.
• Formulation: 50% glycerol
• Gene: CARD11
• Gene Accession No.: NM_032415
• Gene Alias: BIMP3/CARMA1/MGC133069
• Gene Symbols: CARD11
• Host Species: Mouse
• Immunogen: CARD11 (NP_115791, 481 a.a. to 580 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 84433
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only