CCL17, Mouse, Clone: 2E7, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant CCL17.

Supplier:  Abnova Corporation H00006361M07A

Catalog No. 89-105-416

Description

This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for T lymphocytes, but not monocytes or granulocytes. The product of this gene binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells. [provided by RefSeq

Sequence: ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS

Specifications

• Antigen: CCL17
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_002987.2
• Gene Symbols: CCL17
• Immunogen: CCL17 (NP_002978.1,24 a.a. ∽ 94 a.a) full-length recombinant protein.
• Regulatory Status: RUO
• Gene ID (Entrez): 6361
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 2E7
• Description: Mouse monoclonal antibody raised against a full-length recombinant CCL17.
• Gene: CCL17
• Gene Alias: A-152E5.3/ABCD-2/MGC138271/MGC138273/SCYA17/TARC
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b κ