Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CCL17, Mouse, Clone: 2E7, Abnova™

Catalog No. 89105416 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-416 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-416 Supplier Abnova Corporation Supplier No. H00006361M07A
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant CCL17.

This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for T lymphocytes, but not monocytes or granulocytes. The product of this gene binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells. [provided by RefSeq

Sequence: ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS

Specifications

Antigen CCL17
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2E7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant CCL17.
Formulation ascites with no preservative
Gene CCL17
Gene Accession No. NM_002987.2
Gene Alias A-152E5.3/ABCD-2/MGC138271/MGC138273/SCYA17/TARC
Gene Symbols CCL17
Host Species Mouse
Immunogen CCL17 (NP_002978.1,24 a.a. ∽ 94 a.a) full-length recombinant protein.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6361
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.