CCL19, Mouse, Clone: 3E9, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant CCL19.

Supplier:  Abnova Corporation H00006363M03A

Catalog No. 89-105-418

Description

This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7. [provided by RefSeq

Sequence: MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS

Specifications

• Antigen: CCL19
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: BC027968
• Gene Symbols: CCL19
• Immunogen: CCL19 (AAH27968,1 a.a. ∽ 98 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 6363
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA
• Clone: 3E9
• Description: Mouse monoclonal antibody raised against a full-length recombinant CCL19.
• Gene: CCL19
• Gene Alias: CKb11/ELC/MGC34433/MIP-3b/MIP3B/SCYA19
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgM κ