Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89105410

CCL3, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89105410 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-410 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-410 Supplier Abnova Corporation Supplier No. H00006348A01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant CCL3.

Macrophage inflammatory protein-1 is a so-called monokine that is involved in the acute inflammatory state in the recruitment and activation of polymorphonuclear leukocytes (Wolpe et al., 1988 [PubMed 3279154]). Sherry et al. (1988) [PubMed 3058856] demonstrated 2 protein components of MIP1, called by them alpha and beta.[supplied by OMIM

Sequence: SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA

Specifications

Antigen CCL3
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant CCL3.
Formulation 50% glycerol
Gene CCL3
Gene Accession No. NM_002983
Gene Alias G0S19-1/LD78ALPHA/MIP-1-alpha/MIP1A/SCYA3
Gene Symbols CCL3
Host Species Mouse
Immunogen CCL3 (NP_002974, 24 a.a. to 92 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6348
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Antisera
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.