CCNB3, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-107-482	50 μL

Catalog No. 89-107-482 Supplier Abnova Corporation Supplier No. H00085417A01

Description

Mouse polyclonal antibody raised against a partial recombinant CCNB3.

The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. Studies of similar genes in chick and Drosophila suggest that this cyclin may associate with CDC2 and CDK2 kinases, and be required for proper spindle reorganization and restoration of the interphase nucleus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: VQEKASKLAAASLLLALYMKKLGYWVPFLEHYSGYSISELHPLVRQLNKLLTFSSYDSLKAVYYKYSHPVFFEVAKIPALDMLKLEEILNCDCEAQGLVL

Specifications

• Antigen: CCNB3
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CCNB3.
• Formulation: 50% glycerol
• Gene: CCNB3
• Gene Accession No.: NM_033031
• Gene Symbols: CCNB3
• Host Species: Mouse
• Immunogen: CCNB3 (NP_149020, 1296 a.a. to 1395 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 85417
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only