CD3D, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-215	50 μL

Catalog No. 89-104-215 Supplier Abnova Corporation Supplier No. H00000915A01

Description

Mouse polyclonal antibody raised against a partial recombinant CD3D.

The protein encoded by this gene is part of the T-cell receptor/CD3 complex (TCR/CD3 complex) and is involved in T-cell development and signal transduction. The encoded membrane protein represents the delta subunit of the CD3 complex, and along with four other CD3 subunits, binds either TCR alpha/beta or TCR gamma/delta to form the TCR/CD3 complex on the surface of T-cells. Defects in this gene are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (SCIDBNK). Two transcript variants encoding different isoforms have been found for this gene. Other variants may also exist, but the full-length natures of their transcripts has yet to be defined. [provided by RefSeq

Sequence: FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELD

Specifications

• Antigen: CD3D
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CD3D.
• Formulation: 50% glycerol
• Gene: CD3D
• Gene Accession No.: NM_000732
• Gene Alias: CD3-DELTA/T3D
• Gene Symbols: CD3D
• Host Species: Mouse
• Immunogen: CD3D (NP_000723, 22 a.a. to 100 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 915
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only