CD3G, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-216	50 μL

Catalog No. 89-104-216 Supplier Abnova Corporation Supplier No. H00000917A01

Description

Mouse polyclonal antibody raised against a partial recombinant CD3G.

The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency. [provided by RefSeq

Sequence: QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELN

Specifications

• Antigen: CD3G
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CD3G.
• Formulation: 50% glycerol
• Gene: CD3G
• Gene Accession No.: NM_000073
• Gene Alias: CD3-GAMMA/FLJ17620/FLJ17664/FLJ79544/FLJ94613/MGC138597/T3G
• Gene Symbols: CD3G
• Host Species: Mouse
• Immunogen: CD3G (NP_000064, 23 a.a. to 111 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 917
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only