CD46, Mouse, Clone: 1B6, Abnova™

Catalog No.	Quantity
89-104-899	200 μL

Catalog No. 89-104-899 Supplier Abnova Corporation Supplier No. H00004179M14A

Description

Mouse monoclonal antibody raised against a partial recombinant MCP.

The protein encoded by this gene is a type I membrane protein and is a regulatory part of the complement system. The encoded protein has cofactor activity for inactivation of complement components C3b and C4b by serum factor I, which protects the host cell from damage by complement. In addition, the encoded protein can act as a receptor for the Edmonston strain of measles virus, human herpesvirus-6, and type IV pili of pathogenic Neisseria. Finally, the protein encoded by this gene may be involved in the fusion of the spermatozoa with the oocyte during fertilization. This gene is found in a cluster on chromosome 1q32 with other genes encoding structural components of the complement system. At least fourteen different transcript variants encoding fourteen different isoforms have been found for this gene. [provided by RefSeq

Sequence: EEPPTFEAMELIGKPKPYYEIGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETCPYIRDPLNGQAVPANGTYEFGYQMHFICNEGYYLIG

Specifications

• Antigen: CD46
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1B6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MCP.
• Formulation: ascites with no preservative
• Gene: CD46
• Gene Accession No.: BC030594
• Gene Alias: MCP/MGC26544/MIC10/TLX/TRA2.10
• Gene Symbols: CD46
• Host Species: Mouse
• Immunogen: CD46 (AAH30594,36 a.a. ∽ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4179
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ